Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for Wanderer09
    1. Wanderer09 Lv 1
    100 pts. 10,161
  2. Avatar for Galaxie 2. Galaxie Lv 1 95 pts. 10,152
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 10,137
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 84 pts. 10,132
  5. Avatar for LociOiling 5. LociOiling Lv 1 79 pts. 10,128
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 75 pts. 10,127
  7. Avatar for BackBuffer 7. BackBuffer Lv 1 70 pts. 10,124
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 66 pts. 10,123
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 62 pts. 10,121
  10. Avatar for MicElephant 10. MicElephant Lv 1 58 pts. 10,112

Comments