Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,153
  2. Avatar for Go Science 2. Go Science 68 pts. 10,137
  3. Avatar for Contenders 3. Contenders 44 pts. 10,112
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,040
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,024
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,007
  7. Avatar for SHELL 7. SHELL 5 pts. 9,933
  8. Avatar for Australia 8. Australia 3 pts. 9,929
  9. Avatar for WISE 380 Spring 21 A 9. WISE 380 Spring 21 A 1 pt. 9,773
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,700

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,153
  2. Avatar for LociOiling 2. LociOiling Lv 1 47 pts. 10,149
  3. Avatar for gmn 3. gmn Lv 1 19 pts. 10,146
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 7 pts. 10,135
  5. Avatar for silent gene 5. silent gene Lv 1 2 pts. 10,131
  6. Avatar for alcor29 6. alcor29 Lv 1 1 pt. 10,018
  7. Avatar for fpc 7. fpc Lv 1 1 pt. 10,007
  8. Avatar for Oransche 8. Oransche Lv 1 1 pt. 9,872

Comments