Placeholder image of a protein
Icon representing a puzzle

2291: Electron Density Reconstruction 36

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
April 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's a lot of copies of the same protein here, making quite the protein architecture. Trim tool highly recommended!

Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV

Top groups


  1. Avatar for SHELL 11. SHELL 1 pt. 85,995
  2. Avatar for Folders 12. Folders 1 pt. 48,326
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 43,186

  1. Avatar for furi0us 61. furi0us Lv 1 1 pt. 98,812
  2. Avatar for equilibria 62. equilibria Lv 1 1 pt. 98,661
  3. Avatar for bamh 63. bamh Lv 1 1 pt. 94,406
  4. Avatar for 42022109 64. 42022109 Lv 1 1 pt. 85,995
  5. Avatar for drjr 65. drjr Lv 1 1 pt. 82,292
  6. Avatar for Internautant 66. Internautant Lv 1 1 pt. 68,379
  7. Avatar for ucad 67. ucad Lv 1 1 pt. 66,650
  8. Avatar for WuWTq 68. WuWTq Lv 1 1 pt. 54,279
  9. Avatar for Zitronenfalter 69. Zitronenfalter Lv 1 1 pt. 48,326
  10. Avatar for Sci1017 70. Sci1017 Lv 1 1 pt. 45,938

Comments


Bruno Kestemont Lv 1

Memory usage:
-base shake or wiggle sidechains: about 1100 Mo
-auto structure: +1000 Mo
-running a recipe using recentbest: + 5000 Mo
(https://fold.it/recipes/108253)
-limitting graph length and mem usage has no effect so far (I didn't reach more than 3-4 undos yet)
-working on a trimmed zone keeps the base memory (about 1500 Mo) and doesn't explose mem usage when running a recipe.

If you discover other tips, please write them here ;)

Sandrix72 Lv 1

In the last time the price of the memory was falling significantly. It is not a joke, I should by memory, because that 32GB is not enough in case of very big proteins (using 16 cores).
:) :) :)

horowsah Staff Lv 1

Just a note on the puzzle size and issues that it causes, just a reminder that the Trim tool is built to help in these cases, as we anticipate wiggling and shaking all will cause problems if it's completely untrimmed. Now if these crashes happen on small trimmed portions, that's another issue…