Placeholder image of a protein
Icon representing a puzzle

2291: Electron Density Reconstruction 36

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
April 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's a lot of copies of the same protein here, making quite the protein architecture. Trim tool highly recommended!

Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV

Top groups


  1. Avatar for SHELL 11. SHELL 1 pt. 85,995
  2. Avatar for Folders 12. Folders 1 pt. 48,326
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 43,186

  1. Avatar for klbklb 71. klbklb Lv 1 1 pt. 43,589
  2. Avatar for rmoretti 72. rmoretti Lv 1 1 pt. 43,186
  3. Avatar for pruneau_44 73. pruneau_44 Lv 1 1 pt. 43,156
  4. Avatar for lconor 74. lconor Lv 1 1 pt. 43,104
  5. Avatar for fiendish_ghoul 75. fiendish_ghoul Lv 1 1 pt. 43,104
  6. Avatar for 6raindog 76. 6raindog Lv 1 1 pt. 43,104

Comments


Bruno Kestemont Lv 1

Memory usage:
-base shake or wiggle sidechains: about 1100 Mo
-auto structure: +1000 Mo
-running a recipe using recentbest: + 5000 Mo
(https://fold.it/recipes/108253)
-limitting graph length and mem usage has no effect so far (I didn't reach more than 3-4 undos yet)
-working on a trimmed zone keeps the base memory (about 1500 Mo) and doesn't explose mem usage when running a recipe.

If you discover other tips, please write them here ;)

Sandrix72 Lv 1

In the last time the price of the memory was falling significantly. It is not a joke, I should by memory, because that 32GB is not enough in case of very big proteins (using 16 cores).
:) :) :)

horowsah Staff Lv 1

Just a note on the puzzle size and issues that it causes, just a reminder that the Trim tool is built to help in these cases, as we anticipate wiggling and shaking all will cause problems if it's completely untrimmed. Now if these crashes happen on small trimmed portions, that's another issue…