Placeholder image of a protein
Icon representing a puzzle

2291: Electron Density Reconstruction 36

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
April 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's a lot of copies of the same protein here, making quite the protein architecture. Trim tool highly recommended!

Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 148,241
  2. Avatar for Go Science 2. Go Science 65 pts. 147,207
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 146,013
  4. Avatar for Contenders 4. Contenders 24 pts. 145,532
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 144,970
  6. Avatar for Australia 6. Australia 7 pts. 143,120
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 141,976
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 138,785
  9. Avatar for VeFold 9. VeFold 1 pt. 135,571
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 115,085

  1. Avatar for NinjaGreg 51. NinjaGreg Lv 1 1 pt. 127,861
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 1 pt. 127,718
  3. Avatar for Flagg65a 53. Flagg65a Lv 1 1 pt. 123,784
  4. Avatar for Idiotboy 54. Idiotboy Lv 1 1 pt. 120,987
  5. Avatar for phi16 55. phi16 Lv 1 1 pt. 120,753
  6. Avatar for Borets 56. Borets Lv 1 1 pt. 115,085
  7. Avatar for deathbat_87 57. deathbat_87 Lv 1 1 pt. 110,910
  8. Avatar for froschi2 58. froschi2 Lv 1 1 pt. 110,869
  9. Avatar for mart0258 59. mart0258 Lv 1 1 pt. 107,799
  10. Avatar for mengzach 60. mengzach Lv 1 1 pt. 107,198

Comments


Bruno Kestemont Lv 1

Memory usage:
-base shake or wiggle sidechains: about 1100 Mo
-auto structure: +1000 Mo
-running a recipe using recentbest: + 5000 Mo
(https://fold.it/recipes/108253)
-limitting graph length and mem usage has no effect so far (I didn't reach more than 3-4 undos yet)
-working on a trimmed zone keeps the base memory (about 1500 Mo) and doesn't explose mem usage when running a recipe.

If you discover other tips, please write them here ;)

Sandrix72 Lv 1

In the last time the price of the memory was falling significantly. It is not a joke, I should by memory, because that 32GB is not enough in case of very big proteins (using 16 cores).
:) :) :)

horowsah Staff Lv 1

Just a note on the puzzle size and issues that it causes, just a reminder that the Trim tool is built to help in these cases, as we anticipate wiggling and shaking all will cause problems if it's completely untrimmed. Now if these crashes happen on small trimmed portions, that's another issue…