Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 28,685
  2. Avatar for SHELL 12. SHELL 1 pt. 28,323
  3. Avatar for Folders 13. Folders 1 pt. 28,186
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 14,918
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 31,487
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 95 pts. 31,430
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 89 pts. 31,371
  4. Avatar for drjr 4. drjr Lv 1 84 pts. 31,350
  5. Avatar for BackBuffer 5. BackBuffer Lv 1 79 pts. 31,328
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 74 pts. 31,316
  7. Avatar for Galaxie 7. Galaxie Lv 1 70 pts. 31,314
  8. Avatar for gmn 8. gmn Lv 1 66 pts. 31,264
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 62 pts. 31,246
  10. Avatar for silent gene 10. silent gene Lv 1 58 pts. 31,237

Comments