Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 31,503
  2. Avatar for Go Science 2. Go Science 68 pts. 31,371
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 31,135
  4. Avatar for Contenders 4. Contenders 27 pts. 31,115
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 31,044
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 30,998
  7. Avatar for Australia 7. Australia 5 pts. 30,581
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 30,156
  9. Avatar for VeFold 9. VeFold 1 pt. 30,049
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 28,773

  1. Avatar for Ratissar 81. Ratissar Lv 1 1 pt. 15,497
  2. Avatar for samjs50@icloud.com 82. samjs50@icloud.com Lv 1 1 pt. 14,971
  3. Avatar for pr0tfold 83. pr0tfold Lv 1 1 pt. 14,918
  4. Avatar for spvincent 84. spvincent Lv 1 1 pt. 14,918
  5. Avatar for AlphaFold2 85. AlphaFold2 Lv 1 1 pt. 14,918
  6. Avatar for fiendish_ghoul 86. fiendish_ghoul Lv 1 1 pt. 14,918

Comments