Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,381
  2. Avatar for Aubade01 2. Aubade01 Lv 1 94 pts. 10,251
  3. Avatar for grogar7 3. grogar7 Lv 1 89 pts. 10,220
  4. Avatar for blazegeek 4. blazegeek Lv 1 83 pts. 10,173
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 78 pts. 10,172
  6. Avatar for Idiotboy 6. Idiotboy Lv 1 73 pts. 10,163
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 10,146
  8. Avatar for MicElephant 8. MicElephant Lv 1 64 pts. 10,120
  9. Avatar for guineapig 9. guineapig Lv 1 60 pts. 10,119
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 56 pts. 10,094

Comments