Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,381
  2. Avatar for Go Science 2. Go Science 65 pts. 10,165
  3. Avatar for Contenders 3. Contenders 41 pts. 10,120
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,000
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 9,917
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,847
  7. Avatar for AlphaFold 7. AlphaFold 4 pts. 9,804
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,722
  9. Avatar for Australia 9. Australia 1 pt. 9,709
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,271

  1. Avatar for NAUL 81. NAUL Lv 1 1 pt. 6,482
  2. Avatar for U202241721 82. U202241721 Lv 1 1 pt. 6,482

Comments