Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 23,066
  2. Avatar for SHELL 12. SHELL 1 pt. 22,985
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 22,984
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,929
  5. Avatar for JAWS PLAYERS 15. JAWS PLAYERS 1 pt. 22,601
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 23,547
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 23,543
  3. Avatar for Galaxie 3. Galaxie Lv 1 89 pts. 23,541
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 83 pts. 23,536
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 78 pts. 23,535
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 74 pts. 23,531
  7. Avatar for MicElephant 7. MicElephant Lv 1 69 pts. 23,524
  8. Avatar for maithra 8. maithra Lv 1 65 pts. 23,518
  9. Avatar for g_b 9. g_b Lv 1 60 pts. 23,517
  10. Avatar for gmn 10. gmn Lv 1 56 pts. 23,514

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL