Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,903
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,799
  3. Avatar for VeFold 13. VeFold 1 pt. 9,768
  4. Avatar for Ogre's lab 14. Ogre's lab 1 pt. 9,722
  5. Avatar for Team China 15. Team China 1 pt. 9,074
  6. Avatar for SHELL 16. SHELL 1 pt. 4,734
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,943
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 10,802
  3. Avatar for blazegeek 3. blazegeek Lv 1 89 pts. 10,719
  4. Avatar for grogar7 4. grogar7 Lv 1 83 pts. 10,634
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 78 pts. 10,632
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 74 pts. 10,630
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 10,623
  8. Avatar for Aubade01 8. Aubade01 Lv 1 65 pts. 10,601
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 60 pts. 10,589
  10. Avatar for Galaxie 10. Galaxie Lv 1 56 pts. 10,545

Comments