Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,419
  2. Avatar for blazegeek 2. blazegeek Lv 1 95 pts. 10,378
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 90 pts. 10,322
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 85 pts. 10,310
  5. Avatar for grogar7 5. grogar7 Lv 1 81 pts. 10,262
  6. Avatar for Galaxie 6. Galaxie Lv 1 76 pts. 10,262
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 72 pts. 10,202
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 68 pts. 10,168
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 64 pts. 10,151
  10. Avatar for Aubade01 10. Aubade01 Lv 1 61 pts. 10,144

Comments