Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,419
  2. Avatar for Go Science 2. Go Science 65 pts. 10,310
  3. Avatar for Contenders 3. Contenders 41 pts. 10,151
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,124
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,121
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,975
  7. Avatar for Australia 7. Australia 4 pts. 9,836
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,785
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,120
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,730

  1. Avatar for Oransche 31. Oransche Lv 1 15 pts. 9,530
  2. Avatar for heather-1 32. heather-1 Lv 1 14 pts. 9,488
  3. Avatar for akaaka 33. akaaka Lv 1 13 pts. 9,485
  4. Avatar for RichGuilmain 34. RichGuilmain Lv 1 12 pts. 9,483
  5. Avatar for Sissue 35. Sissue Lv 1 11 pts. 9,359
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 10 pts. 9,120
  7. Avatar for rezaefar 37. rezaefar Lv 1 9 pts. 9,080
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 8 pts. 9,038
  9. Avatar for karl07 39. karl07 Lv 1 8 pts. 8,933
  10. Avatar for zbp 40. zbp Lv 1 7 pts. 8,924

Comments