Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,419
  2. Avatar for Go Science 2. Go Science 65 pts. 10,310
  3. Avatar for Contenders 3. Contenders 41 pts. 10,151
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,124
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,121
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,975
  7. Avatar for Australia 7. Australia 4 pts. 9,836
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,785
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,120
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,730

  1. Avatar for hada 41. hada Lv 1 7 pts. 8,909
  2. Avatar for ProfVince 42. ProfVince Lv 1 6 pts. 8,894
  3. Avatar for HavocOrder0999 43. HavocOrder0999 Lv 1 5 pts. 8,889
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 5 pts. 8,820
  5. Avatar for Arne Heessels 45. Arne Heessels Lv 1 5 pts. 8,799
  6. Avatar for phi16 46. phi16 Lv 1 4 pts. 8,792
  7. Avatar for DScott 47. DScott Lv 1 4 pts. 8,790
  8. Avatar for alyssa_d_V2.0 48. alyssa_d_V2.0 Lv 1 3 pts. 8,730
  9. Avatar for XeleX 49. XeleX Lv 1 3 pts. 8,703
  10. Avatar for carxo 50. carxo Lv 1 3 pts. 8,681

Comments