Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,419
  2. Avatar for Go Science 2. Go Science 65 pts. 10,310
  3. Avatar for Contenders 3. Contenders 41 pts. 10,151
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,124
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,121
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,975
  7. Avatar for Australia 7. Australia 4 pts. 9,836
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,785
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,120
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,730
  1. Avatar for silent gene 21. silent gene Lv 1 30 pts. 9,982
  2. Avatar for gmn 22. gmn Lv 1 28 pts. 9,981
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 26 pts. 9,975
  4. Avatar for Idiotboy 24. Idiotboy Lv 1 25 pts. 9,899
  5. Avatar for Skippysk8s 25. Skippysk8s Lv 1 23 pts. 9,870
  6. Avatar for AlkiP0Ps 26. AlkiP0Ps Lv 1 21 pts. 9,836
  7. Avatar for georg137 27. georg137 Lv 1 20 pts. 9,819
  8. Avatar for fpc 28. fpc Lv 1 19 pts. 9,785
  9. Avatar for Hillbillie 29. Hillbillie Lv 1 17 pts. 9,781
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 16 pts. 9,743

Comments