Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,494

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,321
  2. Avatar for Galaxie 2. Galaxie Lv 1 63 pts. 10,320
  3. Avatar for alcor29 3. alcor29 Lv 1 37 pts. 10,309
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 21 pts. 10,292
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 11 pts. 10,289
  6. Avatar for silent gene 6. silent gene Lv 1 5 pts. 10,286
  7. Avatar for phi16 7. phi16 Lv 1 2 pts. 10,215
  8. Avatar for hansvandenhof 8. hansvandenhof Lv 1 1 pt. 10,215
  9. Avatar for jausmh 10. jausmh Lv 1 1 pt. 10,093

Comments