Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,494
  1. Avatar for hada 41. hada Lv 1 2 pts. 9,142
  2. Avatar for heyubob 42. heyubob Lv 1 2 pts. 9,060
  3. Avatar for Merf 43. Merf Lv 1 2 pts. 8,971
  4. Avatar for TooDice 44. TooDice Lv 1 2 pts. 8,963
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 8,854
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 8,853
  7. Avatar for Arne Heessels 47. Arne Heessels Lv 1 1 pt. 8,850
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 8,827
  9. Avatar for AlphaFold2 49. AlphaFold2 Lv 1 1 pt. 8,797
  10. Avatar for Steven Pletsch 50. Steven Pletsch Lv 1 1 pt. 8,757

Comments