Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,494
  1. Avatar for Larini 51. Larini Lv 1 1 pt. 8,741
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 8,692
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 8,667
  4. Avatar for jamiexq 54. jamiexq Lv 1 1 pt. 8,638
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 1 pt. 8,545
  6. Avatar for ShadowTactics 56. ShadowTactics Lv 1 1 pt. 8,494
  7. Avatar for wosser1 57. wosser1 Lv 1 1 pt. 8,445
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 8,430
  9. Avatar for karl07 59. karl07 Lv 1 1 pt. 8,368
  10. Avatar for rezaefar 60. rezaefar Lv 1 1 pt. 8,169

Comments