Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,322
  2. Avatar for Go Science 2. Go Science 60 pts. 10,292
  3. Avatar for Contenders 3. Contenders 33 pts. 10,238
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,105
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 9,929
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 9,925
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,849
  8. Avatar for Australia 8. Australia 1 pt. 9,831
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,797
  10. Avatar for VeFold 10. VeFold 1 pt. 8,667

  1. Avatar for gmn 11. gmn Lv 1 48 pts. 10,139
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 44 pts. 10,129
  3. Avatar for fpc 13. fpc Lv 1 41 pts. 10,105
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 37 pts. 10,055
  5. Avatar for maithra 15. maithra Lv 1 34 pts. 10,033
  6. Avatar for silent gene 16. silent gene Lv 1 32 pts. 10,009
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 29 pts. 10,000
  8. Avatar for g_b 18. g_b Lv 1 27 pts. 9,959
  9. Avatar for roarshock 19. roarshock Lv 1 24 pts. 9,959
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 22 pts. 9,929

Comments