Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,322
  2. Avatar for Go Science 2. Go Science 60 pts. 10,292
  3. Avatar for Contenders 3. Contenders 33 pts. 10,238
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,105
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 9,929
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 9,925
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,849
  8. Avatar for Australia 8. Australia 1 pt. 9,831
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,797
  10. Avatar for VeFold 10. VeFold 1 pt. 8,667

  1. Avatar for rinze 61. rinze Lv 1 1 pt. 8,086
  2. Avatar for drp6 62. drp6 Lv 1 1 pt. 8,008
  3. Avatar for apetrides 63. apetrides Lv 1 1 pt. 7,897
  4. Avatar for WolverineX 64. WolverineX Lv 1 1 pt. 7,873
  5. Avatar for lconor 65. lconor Lv 1 1 pt. 7,773
  6. Avatar for pruneau_44 66. pruneau_44 Lv 1 1 pt. 7,572
  7. Avatar for 41922069LZ 67. 41922069LZ Lv 1 1 pt. 7,467
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 7,367
  9. Avatar for Deleted player 69. Deleted player 1 pt. 7,364
  10. Avatar for pizpot 70. pizpot Lv 1 1 pt. 7,228

Comments