Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 25,228
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 25,215
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 89 pts. 25,178
  4. Avatar for blazegeek 4. blazegeek Lv 1 83 pts. 25,161
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 78 pts. 25,136
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 73 pts. 25,087
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 25,084
  8. Avatar for BackBuffer 8. BackBuffer Lv 1 64 pts. 25,078
  9. Avatar for grogar7 9. grogar7 Lv 1 60 pts. 25,076
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 56 pts. 25,073

Comments