Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 25 pts. 24,823
  2. Avatar for guineapig 22. guineapig Lv 1 23 pts. 24,812
  3. Avatar for maithra 23. maithra Lv 1 21 pts. 24,693
  4. Avatar for phi16 24. phi16 Lv 1 19 pts. 24,670
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 18 pts. 24,664
  6. Avatar for silent gene 26. silent gene Lv 1 16 pts. 24,646
  7. Avatar for alcor29 27. alcor29 Lv 1 15 pts. 24,618
  8. Avatar for ShadowTactics 28. ShadowTactics Lv 1 14 pts. 24,574
  9. Avatar for jausmh 29. jausmh Lv 1 12 pts. 24,516
  10. Avatar for spvincent 30. spvincent Lv 1 11 pts. 24,487

Comments