Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 2 years ago

Summary

• Created: June 22, 2023
• Expires: July 20, 2023 at 22:00 UTC
• Max points: 100

Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

• Sequence: MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

No scores of this type to display!

Top evolvers

No scores of this type to display!