Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 2 years ago

Beginner Beginner

Summary


Created
June 22, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


No scores of this type to display!


  1. Avatar for Wanderer09
    1. Wanderer09 Lv 1
    100 pts. 15,336
  2. Avatar for rosie4loop 2. rosie4loop Lv 1 71 pts. 15,212
  3. Avatar for Deleted player 3. Deleted player 49 pts. 14,843
  4. Avatar for crabapple 4. crabapple Lv 1 33 pts. 14,448
  5. Avatar for Just_A_Nerd 5. Just_A_Nerd Lv 1 22 pts. 14,446
  6. Avatar for CDSoffice 6. CDSoffice Lv 1 14 pts. 14,301
  7. Avatar for davitzeiro42 7. davitzeiro42 Lv 1 8 pts. 14,283
  8. Avatar for AmphotericinB 8. AmphotericinB Lv 1 5 pts. 14,038
  9. Avatar for disorder 9. disorder Lv 1 3 pts. 13,948
  10. Avatar for centropy 10. centropy Lv 1 2 pts. 13,906

Comments