Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner Beginner Beginner Beginner Beginner Beginner Beginner Beginner Beginner

Summary


Created
June 22, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


No scores of this type to display!


  1. Avatar for Quantum_Mareness 11. Quantum_Mareness Lv 1 1 pt. 13,898
  2. Avatar for Igba 12. Igba Lv 1 1 pt. 13,217
  3. Avatar for priyanda 13. priyanda Lv 1 1 pt. 11,537
  4. Avatar for Loken193 14. Loken193 Lv 1 1 pt. 11,417
  5. Avatar for juliaanneduarte 15. juliaanneduarte Lv 1 1 pt. 11,405
  6. Avatar for Jasmine_Young 16. Jasmine_Young Lv 1 1 pt. 11,405

Comments