Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for :) 11. :) 1 pt. 8,974
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,957
  3. Avatar for Cannabis Crew 13. Cannabis Crew 1 pt. 8,911
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,626
  1. Avatar for AlphaFold2 41. AlphaFold2 Lv 1 2 pts. 9,121
  2. Avatar for pfirth 42. pfirth Lv 1 2 pts. 9,115
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 2 pts. 9,084
  4. Avatar for Larini 44. Larini Lv 1 1 pt. 9,072
  5. Avatar for Merf 45. Merf Lv 1 1 pt. 9,070
  6. Avatar for hada 46. hada Lv 1 1 pt. 9,042
  7. Avatar for machinelves 47. machinelves Lv 1 1 pt. 8,974
  8. Avatar for rosie4loop 48. rosie4loop Lv 1 1 pt. 8,959
  9. Avatar for Joanna_H 49. Joanna_H Lv 1 1 pt. 8,957
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 8,951

Comments