Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for :) 11. :) 1 pt. 8,974
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,957
  3. Avatar for Cannabis Crew 13. Cannabis Crew 1 pt. 8,911
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,626
  1. Avatar for evifnoskcaj 61. evifnoskcaj Lv 1 1 pt. 8,496
  2. Avatar for Deleted player 62. Deleted player 1 pt. 8,439
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 8,415
  4. Avatar for ivalnic 64. ivalnic Lv 1 1 pt. 8,395
  5. Avatar for apetrides 65. apetrides Lv 1 1 pt. 8,386
  6. Avatar for argyrw 66. argyrw Lv 1 1 pt. 8,157
  7. Avatar for Mohoernchen 67. Mohoernchen Lv 1 1 pt. 8,026
  8. Avatar for Swapper242 68. Swapper242 Lv 1 1 pt. 7,971
  9. Avatar for Just_A_Nerd 69. Just_A_Nerd Lv 1 1 pt. 7,957
  10. Avatar for pizpot 70. pizpot Lv 1 1 pt. 7,927

Comments