Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for :) 11. :) 1 pt. 8,974
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,957
  3. Avatar for Cannabis Crew 13. Cannabis Crew 1 pt. 8,911
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,626
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 7,887
  2. Avatar for vlaigle 72. vlaigle Lv 1 1 pt. 7,561

Comments