Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,020
  2. Avatar for Contenders 2. Contenders 68 pts. 9,891
  3. Avatar for Go Science 3. Go Science 44 pts. 9,878
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,645
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 9,536
  6. Avatar for Australia 6. Australia 9 pts. 9,487
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,460
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 9,153
  9. Avatar for VeFold 9. VeFold 1 pt. 9,123
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,121

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 8,948
  2. Avatar for rezaefar 52. rezaefar Lv 1 1 pt. 8,941
  3. Avatar for Lord_c_nu 53. Lord_c_nu Lv 1 1 pt. 8,911
  4. Avatar for Steven Pletsch 54. Steven Pletsch Lv 1 1 pt. 8,756
  5. Avatar for zbp 55. zbp Lv 1 1 pt. 8,722
  6. Avatar for dahast.de 56. dahast.de Lv 1 1 pt. 8,626
  7. Avatar for Oransche 57. Oransche Lv 1 1 pt. 8,604
  8. Avatar for ProfVince 58. ProfVince Lv 1 1 pt. 8,571
  9. Avatar for wosser1 59. wosser1 Lv 1 1 pt. 8,537
  10. Avatar for equilibria 60. equilibria Lv 1 1 pt. 8,519

Comments