Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,020
  2. Avatar for Contenders 2. Contenders 68 pts. 9,891
  3. Avatar for Go Science 3. Go Science 44 pts. 9,878
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,645
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 9,536
  6. Avatar for Australia 6. Australia 9 pts. 9,487
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,460
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 9,153
  9. Avatar for VeFold 9. VeFold 1 pt. 9,123
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,121

  1. Avatar for evifnoskcaj 61. evifnoskcaj Lv 1 1 pt. 8,496
  2. Avatar for Deleted player 62. Deleted player 1 pt. 8,439
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 8,415
  4. Avatar for ivalnic 64. ivalnic Lv 1 1 pt. 8,395
  5. Avatar for apetrides 65. apetrides Lv 1 1 pt. 8,386
  6. Avatar for argyrw 66. argyrw Lv 1 1 pt. 8,157
  7. Avatar for Mohoernchen 67. Mohoernchen Lv 1 1 pt. 8,026
  8. Avatar for Swapper242 68. Swapper242 Lv 1 1 pt. 7,971
  9. Avatar for Just_A_Nerd 69. Just_A_Nerd Lv 1 1 pt. 7,957
  10. Avatar for pizpot 70. pizpot Lv 1 1 pt. 7,927

Comments