Icon representing a puzzle

2328: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for A generic group 11. A generic group 1 pt. 8,171
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,137

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 49 pts. 8,944
  2. Avatar for akaaka 12. akaaka Lv 1 45 pts. 8,943
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 42 pts. 8,933
  4. Avatar for MicElephant 14. MicElephant Lv 1 39 pts. 8,921
  5. Avatar for fpc 15. fpc Lv 1 36 pts. 8,900
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 33 pts. 8,862
  7. Avatar for Aubade01 17. Aubade01 Lv 1 30 pts. 8,855
  8. Avatar for guineapig 18. guineapig Lv 1 28 pts. 8,852
  9. Avatar for Wanderer09 19. Wanderer09 Lv 1 25 pts. 8,839
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 23 pts. 8,804

Comments


NinjaGreg Lv 1

I'm getting this error message when I try to open the latest Revisiting, Puzzle 2328:

Files with unrecognized extensions specified:
.otxt

I can't seem to upload the log.txt file, but here's some odd-looking lines:

standalone.application.boinc.Puzzle: {0} .ocmdline d0c38b589470b99976db250c17c71d3d
standalone.application.boinc.Puzzle: {0} .ofilters eb8c2fc8a467c4cf237618a29c45f665
standalone.application.boinc.Puzzle: {0} .opdb a7916996dc6adb777c51f4c4a575fa84
standalone.application.boinc.Puzzle: {0} .opuzzle_setup eddf1be56eb7d97f3a0ce625e923bff7
standalone.application.boinc.Puzzle: {0} .owts d2f7165a0e0f8d0203c093ba8d54267f
standalone.application.boinc.Puzzle: {0} .odensity 0ec96a8677ee654aeb9f398c35788c9a

Is there supposed to be a .o in these names?

blazegeek Lv 1

Same error in Windows. Log file shows this bit of useful info:

standalone.application.boinc.Puzzle: {0} Exception: Files with unrecognized extensions specified: .otxt in C:\Users\jflat06\foldit\develop\source\src\standalone\application\boinc\Puzzle.cc line 1942

apetrides Staff Lv 1

Hi all, this issue should now be fixed. Please let me know if any bugs persist. Happy folding!