Icon representing a puzzle

2328: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,180
  2. Avatar for Go Science 2. Go Science 63 pts. 9,019
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 8,944
  4. Avatar for Contenders 4. Contenders 21 pts. 8,933
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 8,900
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 8,862
  7. Avatar for Australia 7. Australia 2 pts. 8,766
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 8,753
  9. Avatar for VeFold 9. VeFold 1 pt. 8,560
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 8,429

  1. Avatar for Just_A_Nerd 61. Just_A_Nerd Lv 1 1 pt. 7,743
  2. Avatar for silent gene 62. silent gene Lv 1 1 pt. 7,725
  3. Avatar for streakwind 63. streakwind Lv 1 1 pt. 7,660
  4. Avatar for Davidgc2 64. Davidgc2 Lv 1 1 pt. 7,579
  5. Avatar for RileyLee 65. RileyLee Lv 1 1 pt. 7,542
  6. Avatar for Gematron 2874 66. Gematron 2874 Lv 1 1 pt. 7,528
  7. Avatar for 350920 67. 350920 Lv 1 1 pt. 7,514
  8. Avatar for eDNAgent 68. eDNAgent Lv 1 1 pt. 7,487
  9. Avatar for pizpot 69. pizpot Lv 1 1 pt. 7,484
  10. Avatar for prat_03 70. prat_03 Lv 1 1 pt. 7,473

Comments


NinjaGreg Lv 1

I'm getting this error message when I try to open the latest Revisiting, Puzzle 2328:

Files with unrecognized extensions specified:
.otxt

I can't seem to upload the log.txt file, but here's some odd-looking lines:

standalone.application.boinc.Puzzle: {0} .ocmdline d0c38b589470b99976db250c17c71d3d
standalone.application.boinc.Puzzle: {0} .ofilters eb8c2fc8a467c4cf237618a29c45f665
standalone.application.boinc.Puzzle: {0} .opdb a7916996dc6adb777c51f4c4a575fa84
standalone.application.boinc.Puzzle: {0} .opuzzle_setup eddf1be56eb7d97f3a0ce625e923bff7
standalone.application.boinc.Puzzle: {0} .owts d2f7165a0e0f8d0203c093ba8d54267f
standalone.application.boinc.Puzzle: {0} .odensity 0ec96a8677ee654aeb9f398c35788c9a

Is there supposed to be a .o in these names?

blazegeek Lv 1

Same error in Windows. Log file shows this bit of useful info:

standalone.application.boinc.Puzzle: {0} Exception: Files with unrecognized extensions specified: .otxt in C:\Users\jflat06\foldit\develop\source\src\standalone\application\boinc\Puzzle.cc line 1942

apetrides Staff Lv 1

Hi all, this issue should now be fixed. Please let me know if any bugs persist. Happy folding!