Icon representing a puzzle

2328: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,180
  2. Avatar for Go Science 2. Go Science 63 pts. 9,019
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 8,944
  4. Avatar for Contenders 4. Contenders 21 pts. 8,933
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 8,900
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 8,862
  7. Avatar for Australia 7. Australia 2 pts. 8,766
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 8,753
  9. Avatar for VeFold 9. VeFold 1 pt. 8,560
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 8,429
  1. Avatar for crabapple 51. crabapple Lv 1 1 pt. 8,171
  2. Avatar for AlphaFold2 52. AlphaFold2 Lv 1 1 pt. 8,137
  3. Avatar for Oransche 53. Oransche Lv 1 1 pt. 8,131
  4. Avatar for rezaefar 54. rezaefar Lv 1 1 pt. 8,103
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 8,100
  6. Avatar for Alistair69 56. Alistair69 Lv 1 1 pt. 8,095
  7. Avatar for apetrides 57. apetrides Lv 1 1 pt. 8,073
  8. Avatar for klbklb 58. klbklb Lv 1 1 pt. 7,997
  9. Avatar for ProfVince 59. ProfVince Lv 1 1 pt. 7,938
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 7,875

Comments

NinjaGreg Lv 1

I'm getting this error message when I try to open the latest Revisiting, Puzzle 2328:

Files with unrecognized extensions specified:
.otxt

I can't seem to upload the log.txt file, but here's some odd-looking lines:

standalone.application.boinc.Puzzle: {0} .ocmdline d0c38b589470b99976db250c17c71d3d
standalone.application.boinc.Puzzle: {0} .ofilters eb8c2fc8a467c4cf237618a29c45f665
standalone.application.boinc.Puzzle: {0} .opdb a7916996dc6adb777c51f4c4a575fa84
standalone.application.boinc.Puzzle: {0} .opuzzle_setup eddf1be56eb7d97f3a0ce625e923bff7
standalone.application.boinc.Puzzle: {0} .owts d2f7165a0e0f8d0203c093ba8d54267f
standalone.application.boinc.Puzzle: {0} .odensity 0ec96a8677ee654aeb9f398c35788c9a

Is there supposed to be a .o in these names?

blazegeek Lv 1

Same error in Windows. Log file shows this bit of useful info:

standalone.application.boinc.Puzzle: {0} Exception: Files with unrecognized extensions specified: .otxt in C:\Users\jflat06\foldit\develop\source\src\standalone\application\boinc\Puzzle.cc line 1942

apetrides Staff Lv 1

Hi all, this issue should now be fixed. Please let me know if any bugs persist. Happy folding!