Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,562
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 24,551
  3. Avatar for A generic group 13. A generic group 1 pt. 23,327

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 26,973
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 93 pts. 26,918
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 86 pts. 26,832
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 79 pts. 26,793
  5. Avatar for BootsMcGraw 5. BootsMcGraw Lv 1 73 pts. 26,792
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 68 pts. 26,791
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 62 pts. 26,782
  8. Avatar for grogar7 8. grogar7 Lv 1 57 pts. 26,764
  9. Avatar for MicElephant 9. MicElephant Lv 1 52 pts. 26,716
  10. Avatar for silent gene 10. silent gene Lv 1 48 pts. 26,716

Comments