Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,562
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 24,551
  3. Avatar for A generic group 13. A generic group 1 pt. 23,327

  1. Avatar for georg137 31. georg137 Lv 1 5 pts. 26,103
  2. Avatar for zbp 32. zbp Lv 1 4 pts. 26,055
  3. Avatar for ShadowTactics 33. ShadowTactics Lv 1 4 pts. 26,042
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 3 pts. 25,986
  5. Avatar for hada 35. hada Lv 1 3 pts. 25,979
  6. Avatar for ProfVince 36. ProfVince Lv 1 3 pts. 25,886
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 2 pts. 25,737
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 2 pts. 25,659
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 2 pts. 25,644
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 2 pts. 25,615

Comments