Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 26,974
  2. Avatar for Go Science 2. Go Science 65 pts. 26,918
  3. Avatar for Contenders 3. Contenders 41 pts. 26,792
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 26,791
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 26,657
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 26,565
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 26,408
  8. Avatar for Australia 8. Australia 2 pts. 26,342
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 26,042
  10. Avatar for VeFold 10. VeFold 1 pt. 25,002

  1. Avatar for georg137 31. georg137 Lv 1 5 pts. 26,103
  2. Avatar for zbp 32. zbp Lv 1 4 pts. 26,055
  3. Avatar for ShadowTactics 33. ShadowTactics Lv 1 4 pts. 26,042
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 3 pts. 25,986
  5. Avatar for hada 35. hada Lv 1 3 pts. 25,979
  6. Avatar for ProfVince 36. ProfVince Lv 1 3 pts. 25,886
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 2 pts. 25,737
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 2 pts. 25,659
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 2 pts. 25,644
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 2 pts. 25,615

Comments