Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,447
  2. Avatar for VeFold 12. VeFold 1 pt. 10,215
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,333
  2. Avatar for LociOiling 2. LociOiling Lv 1 63 pts. 11,326
  3. Avatar for phi16 3. phi16 Lv 1 37 pts. 11,303
  4. Avatar for gmn 4. gmn Lv 1 21 pts. 11,287
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 11 pts. 11,286
  6. Avatar for alcor29 6. alcor29 Lv 1 5 pts. 11,216
  7. Avatar for silent gene 7. silent gene Lv 1 2 pts. 11,112
  8. Avatar for jausmh 8. jausmh Lv 1 1 pt. 11,058
  9. Avatar for Anfinsen_slept_here 9. Anfinsen_slept_here Lv 1 1 pt. 11,022
  10. Avatar for argyrw 10. argyrw Lv 1 1 pt. 11,016

Comments