Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,447
  2. Avatar for VeFold 12. VeFold 1 pt. 10,215

  1. Avatar for akaaka 21. akaaka Lv 1 21 pts. 11,092
  2. Avatar for alcor29 22. alcor29 Lv 1 19 pts. 11,090
  3. Avatar for phi16 23. phi16 Lv 1 17 pts. 11,090
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 16 pts. 11,087
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 14 pts. 11,083
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 13 pts. 11,052
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 12 pts. 11,052
  8. Avatar for georg137 28. georg137 Lv 1 10 pts. 11,047
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 9 pts. 11,041
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 8 pts. 11,038

Comments