Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,447
  2. Avatar for VeFold 12. VeFold 1 pt. 10,215

  1. Avatar for ProfVince 41. ProfVince Lv 1 2 pts. 10,786
  2. Avatar for nicobul 42. nicobul Lv 1 2 pts. 10,758
  3. Avatar for rosie4loop 43. rosie4loop Lv 1 2 pts. 10,703
  4. Avatar for silent gene 44. silent gene Lv 1 2 pts. 10,654
  5. Avatar for Trajan464 45. Trajan464 Lv 1 1 pt. 10,618
  6. Avatar for Artoria2e5 46. Artoria2e5 Lv 1 1 pt. 10,610
  7. Avatar for Wiz kid 47. Wiz kid Lv 1 1 pt. 10,555
  8. Avatar for Hillbillie 48. Hillbillie Lv 1 1 pt. 10,526
  9. Avatar for Oransche 49. Oransche Lv 1 1 pt. 10,467
  10. Avatar for mailman105 50. mailman105 Lv 1 1 pt. 10,461

Comments