Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,447
  2. Avatar for VeFold 12. VeFold 1 pt. 10,215
  1. Avatar for rezaefar 61. rezaefar Lv 1 1 pt. 10,176
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 10,132
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 10,124
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 1 pt. 10,115
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 1 pt. 10,056
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 9,989
  7. Avatar for Just_A_Nerd 67. Just_A_Nerd Lv 1 1 pt. 9,882
  8. Avatar for Deleted player 68. Deleted player 1 pt. 9,428
  9. Avatar for mignof 69. mignof Lv 1 1 pt. 9,371
  10. Avatar for deathbat_87 70. deathbat_87 Lv 1 1 pt. 9,200

Comments