Placeholder image of a protein
Icon representing a puzzle

2335: Electron Density Reconstruction 51

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 27, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QTVEAMAQGLPAPSYWKNERGSELLIWSANSGTIQGTFTNHAQGFACQGIPYPAAGSVSPTGLYFVVTFAQCNSFTRWVGTIKGSQMPTSWTLFYVDNKGKPSRLKGGDIFTRVW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,040
  2. Avatar for Contenders 2. Contenders 56 pts. 23,014
  3. Avatar for Go Science 3. Go Science 29 pts. 23,014
  4. Avatar for Australia 4. Australia 14 pts. 22,887
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 22,878
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 22,750
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 22,683
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 22,550
  9. Avatar for VeFold 9. VeFold 1 pt. 22,550
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 22,442
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 23,037
  2. Avatar for LociOiling 2. LociOiling Lv 1 76 pts. 23,036
  3. Avatar for phi16 3. phi16 Lv 1 56 pts. 23,027
  4. Avatar for MicElephant 4. MicElephant Lv 1 41 pts. 23,014
  5. Avatar for gmn 5. gmn Lv 1 29 pts. 23,012
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 20 pts. 23,008
  7. Avatar for guineapig 7. guineapig Lv 1 14 pts. 23,006
  8. Avatar for alcor29 8. alcor29 Lv 1 9 pts. 23,004
  9. Avatar for Steven Pletsch 9. Steven Pletsch Lv 1 6 pts. 23,003
  10. Avatar for silent gene 10. silent gene Lv 1 4 pts. 23,003

Comments