Placeholder image of a protein
Icon representing a puzzle

2335: Electron Density Reconstruction 51

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 27, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QTVEAMAQGLPAPSYWKNERGSELLIWSANSGTIQGTFTNHAQGFACQGIPYPAAGSVSPTGLYFVVTFAQCNSFTRWVGTIKGSQMPTSWTLFYVDNKGKPSRLKGGDIFTRVW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,040
  2. Avatar for Contenders 2. Contenders 56 pts. 23,014
  3. Avatar for Go Science 3. Go Science 29 pts. 23,014
  4. Avatar for Australia 4. Australia 14 pts. 22,887
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 22,878
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 22,750
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 22,683
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 22,550
  9. Avatar for VeFold 9. VeFold 1 pt. 22,550
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 22,442
  1. Avatar for maithra 11. maithra Lv 1 2 pts. 23,001
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 1 pt. 22,927
  3. Avatar for Artoria2e5 13. Artoria2e5 Lv 1 1 pt. 22,799
  4. Avatar for georg137 14. georg137 Lv 1 1 pt. 22,794
  5. Avatar for argyrw 15. argyrw Lv 1 1 pt. 22,786
  6. Avatar for ichwilldiesennamen 16. ichwilldiesennamen Lv 1 1 pt. 22,777
  7. Avatar for Oransche 17. Oransche Lv 1 1 pt. 22,555
  8. Avatar for Anfinsen_slept_here 18. Anfinsen_slept_here Lv 1 1 pt. 22,528
  9. Avatar for jausmh 19. jausmh Lv 1 1 pt. 22,332

Comments