Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,094
  2. Avatar for GENETİCS STUDENTS 12. GENETİCS STUDENTS 1 pt. 21,094
  1. Avatar for Wanderer09 21. Wanderer09 Lv 1 16 pts. 52,428
  2. Avatar for nicobul 22. nicobul Lv 1 14 pts. 52,353
  3. Avatar for guineapig 23. guineapig Lv 1 13 pts. 52,138
  4. Avatar for alcor29 24. alcor29 Lv 1 11 pts. 52,080
  5. Avatar for rosie4loop 25. rosie4loop Lv 1 10 pts. 52,049
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 9 pts. 51,936
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 8 pts. 51,587
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 7 pts. 51,581
  9. Avatar for AlphaFold2 29. AlphaFold2 Lv 1 6 pts. 51,566
  10. Avatar for Wiz kid 30. Wiz kid Lv 1 5 pts. 51,404

Comments