Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,094
  2. Avatar for GENETİCS STUDENTS 12. GENETİCS STUDENTS 1 pt. 21,094
  1. Avatar for Trajan464 31. Trajan464 Lv 1 5 pts. 51,381
  2. Avatar for Ilya 32. Ilya Lv 1 4 pts. 51,275
  3. Avatar for Simek 33. Simek Lv 1 4 pts. 51,196
  4. Avatar for hada 34. hada Lv 1 3 pts. 51,140
  5. Avatar for apetrides 35. apetrides Lv 1 3 pts. 50,743
  6. Avatar for maithra 36. maithra Lv 1 2 pts. 50,695
  7. Avatar for Bruno Kestemont 37. Bruno Kestemont Lv 1 2 pts. 50,667
  8. Avatar for Oransche 38. Oransche Lv 1 2 pts. 50,660
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 2 pts. 50,580
  10. Avatar for ProfVince 40. ProfVince Lv 1 1 pt. 50,501

Comments