Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,094
  2. Avatar for GENETİCS STUDENTS 12. GENETİCS STUDENTS 1 pt. 21,094
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 48,051
  2. Avatar for rezaefar 52. rezaefar Lv 1 1 pt. 47,830
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 47,550
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 47,519
  5. Avatar for furi0us 55. furi0us Lv 1 1 pt. 47,388
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 47,176
  7. Avatar for pruneau_44 57. pruneau_44 Lv 1 1 pt. 46,902
  8. Avatar for TgamesPi 58. TgamesPi Lv 1 1 pt. 46,888
  9. Avatar for Larini 59. Larini Lv 1 1 pt. 46,801
  10. Avatar for equilibria 60. equilibria Lv 1 1 pt. 45,626

Comments