Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,094
  2. Avatar for GENETİCS STUDENTS 12. GENETİCS STUDENTS 1 pt. 21,094
  1. Avatar for deathbat_87 61. deathbat_87 Lv 1 1 pt. 44,352
  2. Avatar for koolcoder101 62. koolcoder101 Lv 1 1 pt. 35,775
  3. Avatar for pfirth 63. pfirth Lv 1 1 pt. 21,095
  4. Avatar for Atryx 64. Atryx Lv 1 1 pt. 21,094
  5. Avatar for izzgood 65. izzgood Lv 1 1 pt. 21,094
  6. Avatar for acidwashgenes 66. acidwashgenes Lv 1 1 pt. 21,094

Comments