Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,325
  2. Avatar for Go Science 2. Go Science 63 pts. 53,121
  3. Avatar for Contenders 3. Contenders 37 pts. 53,061
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 52,709
  5. Avatar for Australia 5. Australia 11 pts. 52,429
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 52,353
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,587
  8. Avatar for VeFold 8. VeFold 1 pt. 51,566
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 51,566
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 51,196
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 53,325
  2. Avatar for phi16 2. phi16 Lv 1 56 pts. 53,324
  3. Avatar for LociOiling 3. LociOiling Lv 1 29 pts. 53,323
  4. Avatar for gmn 4. gmn Lv 1 14 pts. 53,302
  5. Avatar for alcor29 5. alcor29 Lv 1 6 pts. 53,299
  6. Avatar for maithra 6. maithra Lv 1 2 pts. 53,026
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 1 pt. 52,585
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 1 pt. 52,573
  9. Avatar for silent gene 9. silent gene Lv 1 1 pt. 52,227
  10. Avatar for Oransche 10. Oransche Lv 1 1 pt. 49,063

Comments