Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 53,325
  2. Avatar for Go Science 2. Go Science 63 pts. 53,121
  3. Avatar for Contenders 3. Contenders 37 pts. 53,061
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 52,709
  5. Avatar for Australia 5. Australia 11 pts. 52,429
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 52,353
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,587
  8. Avatar for VeFold 8. VeFold 1 pt. 51,566
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 51,566
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 51,196

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 53,324
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 93 pts. 53,121
  3. Avatar for Galaxie 3. Galaxie Lv 1 86 pts. 53,063
  4. Avatar for MicElephant 4. MicElephant Lv 1 79 pts. 53,061
  5. Avatar for blazegeek 5. blazegeek Lv 1 73 pts. 53,040
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 67 pts. 52,961
  7. Avatar for gmn 7. gmn Lv 1 62 pts. 52,918
  8. Avatar for grogar7 8. grogar7 Lv 1 57 pts. 52,916
  9. Avatar for phi16 9. phi16 Lv 1 52 pts. 52,854
  10. Avatar for BackBuffer 10. BackBuffer Lv 1 47 pts. 52,729

Comments