Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,834
  2. Avatar for Galaxie 2. Galaxie Lv 1 68 pts. 9,833
  3. Avatar for alcor29 3. alcor29 Lv 1 44 pts. 9,819
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 27 pts. 9,756
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 16 pts. 9,743
  6. Avatar for silent gene 6. silent gene Lv 1 9 pts. 9,741
  7. Avatar for MicElephant 7. MicElephant Lv 1 5 pts. 9,714
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 3 pts. 9,694
  9. Avatar for phi16 9. phi16 Lv 1 1 pt. 9,637
  10. Avatar for maithra 10. maithra Lv 1 1 pt. 9,635

Comments