Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 48 pts. 9,625
  2. Avatar for BackBuffer 12. BackBuffer Lv 1 45 pts. 9,623
  3. Avatar for gmn 13. gmn Lv 1 41 pts. 9,614
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 38 pts. 9,598
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 35 pts. 9,591
  6. Avatar for silent gene 16. silent gene Lv 1 32 pts. 9,587
  7. Avatar for Galaxie 17. Galaxie Lv 1 30 pts. 9,584
  8. Avatar for akaaka 18. akaaka Lv 1 27 pts. 9,569
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 25 pts. 9,559
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 23 pts. 9,516

Comments